ENST00000370519.4 SPANXA1
Information
- Transcript ID
- ENST00000370519.4
- Genome
- hg19
- Position
- chrX:140,671,796-140,672,860
- Strand
- -
- CDS length
- 294
- Amino acid length
- 98
- Gene symbol
- SPANXA1
- Gene type
- protein-coding
- Gene description
- sperm protein associated with the nucleus, X-linked, family member A1
- Gene Entrez Gene ID
- 30014
Variants
Display target variant
Search Word
Target data | : |
MGeND data only
|
Category | : |
|
Search word | : | |
Filtering | : |
Variant name | Gene | AA change | CDS | Japanese frequency |
TogoVar | MGeND | Genome | ClinVar | CIViC evidence | DisGeNET entry | COSMIC occurrence |
Prediction | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Entry | Origin | Type | Annotation | Entry | Origin | Annotation |
Search Word
Target data | : |
MGeND data only
|
Category | : |
|
Search word | : | |
Filtering | : |
Name | MGeND | Type | Genome | Size | Chromosome | Start | Stop | Ref | Alt | ClinVar | Origin | Entry | CIViC evidence | DisGeNET entry | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Entry | Origin | Type | Annotation |
Search Word
Target data | : |
MGeND data only
|
Category | : |
|
Search word | : | |
Filtering | : |
Name | MGeND | Type | Genome | Gene symbol | Chromosome | Genomic start | Genomic stop | Strand | Ref | Alt | ClinVar | Origin | Entry | CIViC evidence | DisGeNET entry | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Entry | Origin | Type | Annotation |
Exon
Exon number | Start | Stop |
---|---|---|
2 | 140,671,796 | 140,672,081 |
1 | 140,672,729 | 140,672,860 |
CDS
Exon number | Type | Start | Stop |
---|---|---|---|
2 | CDS | 140,671,860 | 140,672,081 |
1 | CDS | 140,672,729 | 140,672,800 |
Other genome
Genome | Chromosome | Start | End | Links |
---|---|---|---|---|
hg38 | chrX | 141,583,674 | 141,584,738 | Link |
CDS sequence
ATGGACAAACAATCCAGTGCCGGCGGGGTGAAGAGGAGCGTCCCCTGTGATTCCAACGAGGCCAACGAGATGATGCCGGAGACCCCAACTGGGGACTCAGACCCGCAACCTGCTCCTAAAAAAATGAAAACATCTGAGTCCTCGACCATACTAGTGGTTCGCTACAGGAGGAACTTTAAAAGAACATCTCCAGAGGAACTGCTGAATGACCACGCCCGAGAGAACAGAATCAACCCCCTCCAAATGGAGGAGGAGGAATTCATGGAAATAATGGTTGAAATACCTGCAAAGTAG
Amino sequence
MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK*